05 Apr 2026Updated 05 Apr 2026Research use only

Ll 37 Research

Product image coming soon

View product and buy →

LL-37: Cathelicidin Antimicrobial Peptide Research

LL-37 is a synthetic cathelicidin-derived antimicrobial peptide studied in laboratory settings for its role in innate immune signalling, antimicrobial membrane disruption mechanisms, immunomodulatory pathway studies, and wound healing biology. It is the only cathelicidin in humans, processed from the C-terminal domain of the hCAP18 precursor protein.

Chemical and Molecular Data

Property Value
Molecular formula C205H340N60O53S
Molecular weight 4493.4 g/mol
CAS number 154947-66-7
Sequence [LL-37, 37 aa]
Amino acid count 37
N-terminal LL (Leu-Leu, giving the peptide its name)
Purity greater than or equal to 98% as verified by HPLC
Form Lyophilised powder
Storage -20 degrees C, protected from light and moisture
Reconstitution Sterile water recommended

LL-37: Amphipathic Helix and Membrane Disruption

LL-37 (37 residues) Amphipathic alpha-helix Net charge +6 at pH 7.4 Bacterial membrane Phosphatidylglycerol Cardiolipin (net negative) Membrane disruption Toroidal pore model or carpet mechanism Immunomodulation FPRL1 / P2X7 — DC maturation Cell migration Keratinocyte, fibroblast wound models MW: 4493.4 g/mol — CAS: 154947-66-7 — hCAP18 C-terminal fragment — 37 residues

Structure and Amphipathic Helical Design

LL-37 adopts an alpha-helical conformation in membrane-mimicking environments and in solution at physiological pH. This amphipathic helix is fundamental to its mechanism of action: the helix positions hydrophobic residues on one face and cationic residues on the other, enabling simultaneous insertion into negatively charged bacterial membranes and disruption of membrane integrity.

The cationic nature of LL-37 (net charge approximately +6 at physiological pH) facilitates initial electrostatic attraction to the negatively charged surfaces of bacterial membranes (phosphatidylglycerol and cardiolipin-rich outer leaflets) while mammalian cell membranes, which are predominantly zwitterionic on the outer leaflet (phosphatidylcholine and sphingomyelin), are less susceptible.

Antimicrobial Membrane Biology Research

Laboratory research has examined LL-37's mechanism of bacterial membrane disruption through several proposed models. The toroidal pore model proposes that LL-37 monomers insert into the membrane alongside lipid head groups, forming water-filled pores. The carpet model suggests that LL-37 accumulates on the membrane surface at high concentrations, disrupting membrane integrity through a detergent-like mechanism. Research using membrane model systems (lipid vesicles, black lipid membranes) has investigated which model predominates under different peptide-to-lipid ratios.

Immunomodulatory Research

Beyond direct antimicrobial activity, LL-37 has been studied extensively as an immunomodulatory molecule. Laboratory research has examined its role as an endogenous ligand for several receptors including FPRL1 (formyl peptide receptor-like 1) and P2X7 receptors, and its effects on dendritic cell maturation, T cell polarisation, and macrophage activation in cell culture models.

Research has also examined LL-37 in the context of wound healing, investigating its effects on keratinocyte and fibroblast migration and proliferation — connecting it to BPC-157 and TB-500 research in cellular migration biology.

Cathelicidin Comparison Across Species

Species Cathelicidin Length Key property
Human LL-37 (hCAP18-derived) 37aa Broad spectrum — immunomodulatory
Mouse CRAMP (cathelin-related antimicrobial peptide) 34aa LL-37 homologue in murine research
Rabbit CAP-18 (parent of LL-37 class) 18aa Template for early cathelicidin research
Porcine Protegrin / PR-39 Variable Proline-rich variants

Membrane Disruption Mechanisms in Detail

Two primary structural models have been proposed for LL-37 membrane disruption and are actively investigated in laboratory research:

Toroidal pore model. LL-37 monomers insert perpendicular to the membrane surface alongside lipid head groups, forming water-filled pores that span the bilayer. The lipid-peptide pores cause ion leakage and ultimately membrane disruption. This model predicts concentration-dependent pore formation above a threshold peptide-to-lipid ratio.

Carpet model. At high peptide concentrations, LL-37 accumulates on the outer leaflet of the membrane, orientated parallel to the surface. Above a critical coverage density, the membrane undergoes detergent-like solubilisation and disruption. This model does not require specific pore structures.

Research distinguishing between these models uses solid-state NMR to determine peptide orientation in model membranes, oriented circular dichroism to examine membrane-bound secondary structure, and single-channel electrophysiology to characterise pore conductance.

Frequently Asked Questions

Why is LL-37 named as it is?
LL-37 is named for its N-terminal sequence (Leu-Leu, giving the double-L prefix) and its total length of 37 amino acids. It is cleaved from the C-terminal domain of the precursor protein hCAP18 (human cationic antimicrobial protein of 18 kDa). The hCAP18 precursor is stored in granules of neutrophils and other immune cells and is processed to the active LL-37 fragment by extracellular proteases — primarily proteinase 3.

Does LL-37 selectively target bacteria over mammalian cells?
LL-37 shows preferential activity against bacterial over mammalian cell membranes due to compositional differences. Bacterial membranes are rich in negatively charged phospholipids (phosphatidylglycerol, cardiolipin) that attract the cationic LL-37. Mammalian outer membrane leaflets are predominantly zwitterionic (phosphatidylcholine, sphingomyelin) — less attractive to cationic peptides. However, this selectivity is concentration-dependent: at higher concentrations, LL-37 can disrupt mammalian membranes, which is a consideration in cytotoxicity controls for laboratory research.

Published Research References

Zanetti M. "Cathelicidins, multifunctional peptides of the innate immunity." Journal of Leukocyte Biology, 2004. PMID: 14684947
Mookherjee N, Hancock RE. "Cationic host defence peptides: Innate immune regulatory peptides as a novel approach for treating infections." Cellular and Molecular Life Sciences, 2007. PMID: 17571210

For laboratory and analytical research purposes only. Not for human or veterinary use. No dosage or administration guidance is provided or implied.

Related research peptides: BPC-157 | TB-500 | KPV

View LL-37 product page

Disclaimer: Research use only. Not for human or veterinary use. Not intended to diagnose, treat, cure, or prevent disease.

More articles