Ll 37 Research
Product image coming soon
LL-37: Cathelicidin Antimicrobial Peptide Research
LL-37 is a synthetic cathelicidin-derived antimicrobial peptide studied in laboratory settings for its role in innate immune signalling, antimicrobial membrane disruption mechanisms, immunomodulatory pathway studies, and wound healing biology. It is the only cathelicidin in humans, processed from the C-terminal domain of the hCAP18 precursor protein.
Chemical and Molecular Data
| Property | Value |
|---|---|
| Molecular formula | C205H340N60O53S |
| Molecular weight | 4493.4 g/mol |
| CAS number | 154947-66-7 |
| Sequence | [LL-37, 37 aa] |
| Amino acid count | 37 |
| N-terminal | LL (Leu-Leu, giving the peptide its name) |
| Purity | greater than or equal to 98% as verified by HPLC |
| Form | Lyophilised powder |
| Storage | -20 degrees C, protected from light and moisture |
| Reconstitution | Sterile water recommended |
LL-37: Amphipathic Helix and Membrane Disruption
Structure and Amphipathic Helical Design
LL-37 adopts an alpha-helical conformation in membrane-mimicking environments and in solution at physiological pH. This amphipathic helix is fundamental to its mechanism of action: the helix positions hydrophobic residues on one face and cationic residues on the other, enabling simultaneous insertion into negatively charged bacterial membranes and disruption of membrane integrity.
The cationic nature of LL-37 (net charge approximately +6 at physiological pH) facilitates initial electrostatic attraction to the negatively charged surfaces of bacterial membranes (phosphatidylglycerol and cardiolipin-rich outer leaflets) while mammalian cell membranes, which are predominantly zwitterionic on the outer leaflet (phosphatidylcholine and sphingomyelin), are less susceptible.
Antimicrobial Membrane Biology Research
Laboratory research has examined LL-37's mechanism of bacterial membrane disruption through several proposed models. The toroidal pore model proposes that LL-37 monomers insert into the membrane alongside lipid head groups, forming water-filled pores. The carpet model suggests that LL-37 accumulates on the membrane surface at high concentrations, disrupting membrane integrity through a detergent-like mechanism. Research using membrane model systems (lipid vesicles, black lipid membranes) has investigated which model predominates under different peptide-to-lipid ratios.
Immunomodulatory Research
Beyond direct antimicrobial activity, LL-37 has been studied extensively as an immunomodulatory molecule. Laboratory research has examined its role as an endogenous ligand for several receptors including FPRL1 (formyl peptide receptor-like 1) and P2X7 receptors, and its effects on dendritic cell maturation, T cell polarisation, and macrophage activation in cell culture models.
Research has also examined LL-37 in the context of wound healing, investigating its effects on keratinocyte and fibroblast migration and proliferation — connecting it to BPC-157 and TB-500 research in cellular migration biology.
Cathelicidin Comparison Across Species
| Species | Cathelicidin | Length | Key property |
|---|---|---|---|
| Human | LL-37 (hCAP18-derived) | 37aa | Broad spectrum — immunomodulatory |
| Mouse | CRAMP (cathelin-related antimicrobial peptide) | 34aa | LL-37 homologue in murine research |
| Rabbit | CAP-18 (parent of LL-37 class) | 18aa | Template for early cathelicidin research |
| Porcine | Protegrin / PR-39 | Variable | Proline-rich variants |
Membrane Disruption Mechanisms in Detail
Two primary structural models have been proposed for LL-37 membrane disruption and are actively investigated in laboratory research:
Toroidal pore model. LL-37 monomers insert perpendicular to the membrane surface alongside lipid head groups, forming water-filled pores that span the bilayer. The lipid-peptide pores cause ion leakage and ultimately membrane disruption. This model predicts concentration-dependent pore formation above a threshold peptide-to-lipid ratio.
Carpet model. At high peptide concentrations, LL-37 accumulates on the outer leaflet of the membrane, orientated parallel to the surface. Above a critical coverage density, the membrane undergoes detergent-like solubilisation and disruption. This model does not require specific pore structures.
Research distinguishing between these models uses solid-state NMR to determine peptide orientation in model membranes, oriented circular dichroism to examine membrane-bound secondary structure, and single-channel electrophysiology to characterise pore conductance.
Frequently Asked Questions
Why is LL-37 named as it is?
LL-37 is named for its N-terminal sequence (Leu-Leu, giving the double-L prefix) and its total length of 37 amino acids. It is cleaved from the C-terminal domain of the precursor protein hCAP18 (human cationic antimicrobial protein of 18 kDa). The hCAP18 precursor is stored in granules of neutrophils and other immune cells and is processed to the active LL-37 fragment by extracellular proteases — primarily proteinase 3.
Does LL-37 selectively target bacteria over mammalian cells?
LL-37 shows preferential activity against bacterial over mammalian cell membranes due to compositional differences. Bacterial membranes are rich in negatively charged phospholipids (phosphatidylglycerol, cardiolipin) that attract the cationic LL-37. Mammalian outer membrane leaflets are predominantly zwitterionic (phosphatidylcholine, sphingomyelin) — less attractive to cationic peptides. However, this selectivity is concentration-dependent: at higher concentrations, LL-37 can disrupt mammalian membranes, which is a consideration in cytotoxicity controls for laboratory research.
Published Research References
For laboratory and analytical research purposes only. Not for human or veterinary use. No dosage or administration guidance is provided or implied.
